g NOLOGICALMOLECULES Most amino acids,with the notable exception of glycine,are optically active. Their configurations are usually indicated by the D/L system(Figure 1.4)rather than the R/S system.Most naturally occuring amino acids have an L configur- ation but there are some important exceptions.For example,some bacteria also possess D-amino acids.This is important in the development of some antibac- terial drugs. COOH COOH -NE HN- pdonotaifthCoDLt her projec 1.3 Peptides and protelns ve a (Figure peptide as pep The its nitro atom is able to inter ith the electrons of the Function Notes mple,bone (collagen) Enzymes This is the la estcass of protenAlmost all stpsin biological reati are lysed by en Regulatory ecific co of the body toanothe ins that a n one s to the Storage Protective ns that tect the body.Some form part of the bodies in s th when a blood ves
”±¨ ø³·²± ø½·ºÙ ©·¨¸ ¨¸ª ²±¨ø楪 ª®½ª°¨·±² ±º ¹¥ß½·²ªÙ øƪ ±°¨·½ø¥¥ß ø½¨·™ªÚ øª·Æ ½±²º·¹´Æø¨·±² øƪ ´´ø¥¥ß ·²º·½ø¨ªº æß ¨¸ª ‹Ò‘ ߨª³ ¯⁄·¹´Æª ÔÚϘ Æø¨¸ªÆ ¨¸ø² ¨¸ª ŒÒÕ ß¨ª³Ú ”±¨ ²ø¨´Æø¥¥ß ±½½´Æ·²¹ ø³·²± ø½·º ¸ø™ª ø² ‘ ½±²º·¹´ÆÛ ø¨·±² æ´¨ ¨¸ªÆª øƪ ±³ª ·³°±Æ¨ø²¨ ª®½ª°¨·±²Ú ⁄±Æ ª®ø³°¥ªÙ ±³ª æø½¨ªÆ·ø ø¥± °±ª ‹Ûø³·²± ø½·ºÚ ø· · ·³°±Æ¨ø²¨ ·² ¨¸ª ºª™ª¥±°³ª²¨ ±º ±³ª ø²¨·æø½Û ¨ªÆ·ø¥ ºÆ´¹Ú ÿÓ“ ÿ ›——ÿ Œ ›——ÿ ÿ “ÿÓ Œ ‹ ªÆ·ª ‘ ªÆ·ª ⁄·¹´Æª ÔÚÏ Ã¸ª ‹Ò‘ ½±²º·¹´Æø¨·±² ±º ø³·²± ø½·ºÚ “±¨ª ¨¸ø¨ ¨¸ª ½øÆ汮ߥ·½ ø½·º ¹Æ±´° ³´¨ æª ºÆø©² ø¨ ¨¸ª ¨±° ø²º ¨¸ª Œ ¹Æ±´° ø¨ ¨¸ª 汨¨±³ ±º ¨¸ª ⁄·½¸ªÆ °Æ±¶ª½¨·±²Ú Õ¨ªÆª±¹ª²ª¨·½ ½ª²¨Æª ·² ¨¸ª Œ ¹Æ±´° º± ²±¨ øººª½¨ ¨¸ª ‹Ò‘ ø·¹²³ª²¨ ÔÚ Ì –ª°¨·ºª ø²º °Æ±¨ª·² –ª°¨·ºª ø²º °Æ±¨ª·² ¸ø™ª ø ©·ºª ™øÆ·ª¨ß ±º Ʊ¥ª ·² ¨¸ª ¸´³ø² æ±ºß ¯Ãø楪 ÔÚÓ˜Ú Ã¸ªß ½±²·¨ ±º ø³·²± ø½·º ƪ·º´ª ¥·²µªº ¨±¹ª¨¸ªÆ æß ø³·ºª º´²½¨·±²ø¥ ¹Æ±´° ¯⁄·¹´Æª ÔÚίø˜ ˜Ù ©¸·½¸ ·² °ª°¨·ºª ø²º °Æ±¨ª·² øƪ ƪºªÆƪº ¨± ø °ª°¨·ºª ¥·²µ ¯⁄·¹´Æª ÔÚί½˜ ˜Ú øª ø³·ºª ¹Æ±´° ¸ø ø Æ·¹·º º¥ø¨ ¨Æ´½¨´ÆªÚ øª ¥±²ª °ø·Æ ±º ·¨ ²·¨Æ±¹ª² ø¨±³ · ø楪 ¨± ·²¨ªÆø½¨ ©·¨¸ ¨¸ª ° ª¥ª½¨Æ±² ±º ¨¸ª ½øÆ汲ߥ ¹Æ±´°Ú Ãø楪 ÔÚÓ ¤®ø³°¥ª ±º ±³ª ±º ¨¸ª æ·±¥±¹·½ø¥ º´²½¨·±² ±º °Æ±¨ª·² ⁄´²½¨·±² “±¨ª ըƴ½¨´Æø¥ øªª °Æ±¨ª·² °Æ±™·ºª ¨Æª²¹¨¸ ø²º ª¥ø¨·½·¨ß ¨±Ù º±Æ ª®ø³°¥ªÙ æ±²ª ¯½±¥¥ø¹ª²˜Ù ¸ø·Æ ¯øÛµªÆø¨·²˜ ø²º ½±²²ª½¨·™ª ¨·´ª ¯ª¥ø¨·²˜Ú ¤²¶ß³ª ø· · ¨¸ª ¥øƹª¨ ½¥ø ±º °Æ±¨ª·²Ú fl¥³±¨ ø¥¥ ¨ª° ·² æ·±¥±¹·½ø¥ ƪø½¨·±² øƪ ½ø¨ø¥ßªº æß ª²¶ß³ªÚ Œª¹´¥ø¨±Æß Ã¸ªª øƪ °Æ±¨ª·² ¨¸ø¨ ½±²¨Æ±¥ ¨¸ª °¸ß·±¥±¹·½ø¥ ø½¨·™·¨ß ±º ±¨¸ªÆ °Æ±¨ª·²Ú ײ´¥·²Ù º±Æ ª®ø³°¥ªÙ ƪ¹´¥ø¨ª ¹¥´½±ª ³ª¨øæ±¥·³ ·² ³ø³³ø¥Ú ÃÆø²°±Æ¨ øªª ¨Æø²°±Æ¨ °ª½·º·½ ½±³°±´²º ºÆ±³ ±²ª °øƨ ±º ¨¸ª æ±ºß ¨± ø²±¨¸ªÆ ¸øª³±¹¥±æ·² ¨Æø²°±Æ¨ ½øÆæ±² º·±®·ºª ¨±± ø²º ±®ß¹ª² ºÆ±³ ¨¸ª ¥´²¹Ú ›ª¥¥ ³ª³æÆø²ª ½±²¨ø·² °Æ±¨ª·² ¨¸ø¨ øƪ ƪ°±²·æ¥ª º±Æ ¨¸ª ¨Æø²°±Æ¨ ±º °ª½·ª ºÆ±³ ±²ª ·ºª ±º ¨¸ª ³ª³æÆø²ª ¨± ¨¸ª ±¨¸ªÆÚ Õ¨±Æø¹ª øªª °Æ±™·ºª ø ¨±Æª ±º ´æ¨ø²½ª ƪش·Æªº æß ¨¸ª 決ßÚ ⁄±Æ ª®ø³°¥ªÙ ¨¸ª °Æ±¨ª·² ºªÆÆ·¨·² ø½¨ ø ø² ·Æ±² ¨±Æª º±Æ ¨¸ª 決ßÚ –Ʊ¨ª½¨·™ª øªª °Æ±¨ª·² ¨¸ø¨ °Æ±¨ª½¨ ¨¸ª 決ßÚ Õ±³ª º±Æ³ °øƨ ±º ¨¸ª 決·ª ·³³´²ª ߨª³ ºªºª²º·²¹ ¨¸ª æ±ºß ø¹ø·²¨ º±Æª·¹² ³±¥ª½´¥ª ø²º æø½¨ªÆ·øÚ —¨¸ªÆÙ ´½¸ ø ¨¸ª 楱±º ½¥±¨¨·²¹ ø¹ª²¨ ¨¸Æ±³æ·² ø²º º·æÆ·²±¹ª²Ù °Æª™ª²¨ ¥± ±º 楱±º ©¸ª² ø 楱±º ™ªª¥ · ºø³ø¹ªºÚ Ï fi×—‘—Ÿ×›fl‘ ”—‘¤›À‘¤Õ
PEFTIDES AND PROTEINS 5 -co-N a H<心 Structural formula Atomic orbital Resonance representation structure R 「 1 NH. H-CO H-CO-NH-C ) N-Terminal NH- group group Peptide links R R g H UH Flgure15(包Thestr de()T ttofteanitfaetoagopTeBanlstnctareofipb and the Pharmacology ndmScence,196,publiabed by Prentice Hall,a L昨Scie cation Company delocalization is explained by y the P orbital。 verlap and is usually sed fo nd。th。 contain mallnumbers whilst 0 the te for ompounds with relativ t500 or more.Proteins are more comner no ，with RMM values u aple when their structures contain
› “ › “ — — ñ ÿ ÿ ÿ “ › — Œ ›ÿ ›— “ÿ ›ÿ Œ “ÿÓÛ›ÿÛ›— “ÿ ›——ÿ Œ ² ¯æ˜ –ª°¨·ºª ¥·²µ ›ÛêƳ·²ø¥ ¹Æ±´° “ÛêƳ·²ø¥ ¹Æ±´° fl fl fl fi fi fi ¯ø˜ › ÿ › ÿ “ › — Œ — ÿ › “ ÿ Œ Œ — › ÿ ÿ › “ ¯½˜ ı ըƴ½¨´Æø¥ º±Æ³´¥ø fl¨±³·½ ±Ææ·¨ø¥ ¨Æ´½¨´Æª Œª±²ø²½ª ƪ°Æªª²¨ø¨·±² ›— “ Ú Ú ÿ Ú Ú Ú Ú ⁄·¹´Æª ÔÚÎ ¯ø˜ øª ¨Æ´½¨´Æª ±º ¨¸ª ø³·ºª º´²½¨·±²ø¥ ¹Æ±´°Ú ¯æ˜ øª ¹ª²ªÆø¥ ¨Æ´½¨´Æª ±º ·³°¥ª °ª°¨·ºªÚ ¯½˜ øª °ª°¨·ºª ¥·²µ · °¥ø²øÆ ø²º ¸ø ø Æ·¹·º ½±²¶´¹ø¨ªº ¨Æ´½¨´ÆªÚ ›¸ø²¹ª ·² ½±²º±Æ³Û ø¨·±² ½ø² ±½½´Æ øæ±´¨ æ±²º fl ø²º fiÚ flºø°¨ªº ºÆ±³ Ÿ ø±³øÙ ›¸ª³·¨Æß º±Æ –¸øƳø½ß ø²º ¨¸ª ‘·ºª Õ½·ª²½ª ·²½¥´º·²¹ –¸øƳø½±¥±¹ß ø²º fi·±³ªº·½ø¥ Õ½·ª²½ªÙ ÔÁÁÍÙ °´æ¥·¸ªº æß –ƪ²¨·½ª ÿø¥¥Ù ø –ªøƱ² ¤º´½ø¨·±² ›±³°ø²ß ø· ª¥ª½¨Æ±² ºª¥±½ø¥·¶ø¨·±² · ª®°¥ø·²ªº æß ° ±Ææ·¨ø¥ ±™ªÆ¥ø° ø²º · ´´ø¥¥ß ¸±©² æß ¨¸ª ´ª ±º ƪ±²ø²½ª ¨Æ´½¨´Æª ¯⁄·¹´Æª ÔÚίø˜ ˜Ú øª ¨ªÆ³ °ª°¨·ºª · ²±Æ³ø¥¥ß ´ªº º±Æ ½±³°±´²º ¨¸ø¨ ½±²¨ø·² ³ø¥¥ ²´³æªÆ ±º ø³·²± ø½·º ƪ·º´ª ©¸·¥¨ ¨¸ª ¨ªÆ³ °±¥ß°ª°¨·ºª · ¥±±ª¥ß ´ªº º±Æ ¥øƹªÆ ½±³°±´²º ©·¨¸ ƪ¥ø¨·™ª ³±¥ª½´¥øÆ ³ø ¯Œ”˜ ™ø¥´ª ¹Æªø¨ªÆ ¨¸ø² øæ±´¨ Îðð ±Æ ³±ÆªÚ –Ʊ¨ª·² øƪ ³±Æª ½±³°¥ª® °±¥ß°ª°¨·ºª ©·¨¸ Œ” ™ø¥´ª ´´ø¥¥ß ¹Æªø¨ªÆ ¨¸ø² ÓðððÚ Ã¸ªß øƪ ½¥ø·º·ªº ø ·³°¥ª ©¸ª² ¨¸ª·Æ ¨Æ´½¨´Æª ½±²¨ø·² –¤–Ã׋¤Õ fl“‹ –Œ—Ã¤×“Õ Î
MOLOGICAL MOLECULES only amino acid residues and conjugated when other residues besides those of amino acids occur as integral parts of their structures.For example,haemo- globin is a conjugated protein because its structure contains a haem residue (Figure 1.6).These non-amino-acid residucs are known as prosthetic groups when they are involved in the biological activity of the molecule.Conjugated proteins are classified according to the chemical nature of their non-amino-acid component.For example,glycoproteins contain a carbohydrate residue, haemoproteins a haem group and lipoproteins a lipid residue. 1.3.1 Structure ptides and aiduesGpwoteusg 2 1 nd 1.7.These chair branched due to the chain (Figure 1.7(d)).In addition.bridges (cross links)may be formed bety different sections of the same chain or different chains.Cy teine residues.for example,are responsible for the SS bridges between the two eptide chains that form the struc re of insulin (Figure 1.7(e)).The basic stru of otides and proteins is twisted into a confor nation (time depepdent overall shape)character- istic of that eptide or protein.These conformations are dep endent on both the nature of their biological environment as well as their chemical structures.The ability of peptides and proteins to carry out their biological functions is normally dependent on this conformation.Any changes to any part of the structure of a ooc HCO NHCO nn. COOH H.C C -CH -N N CH CH 0 CH CH (a)Deoxy-haemoglobin (deoxy-Hb) (b)Oxy-hsemoglobin (oxy-Hb) deoxy-Hb the
±²¥ß ø³·²± ø½·º ƪ·º´ª ø²º ½±²¶´¹ø¨ªº ©¸ª² ±¨¸ªÆ ƪ·º´ª 檷ºª ¨¸±ª ±º ø³·²± ø½·º ±½½´Æ ø ·²¨ª¹Æø¥ °øƨ ±º ¨¸ª·Æ ¨Æ´½¨´ÆªÚ ⁄±Æ ª®ø³°¥ªÙ ¸øª³±Û ¹¥±æ·² · ø ½±²¶´¹ø¨ªº °Æ±¨ª·² 檽ø´ª ·¨ ¨Æ´½¨´Æª ½±²¨ø·² ø ¸øª³ ƪ·º´ª ¯⁄·¹´Æª ÔÚÍ˜Ú Ã¸ªª ²±²Ûø³·²±Ûø½·º ƪ·º´ª øƪ µ²±©² ø °Æ±¨¸ª¨·½ ¹Æ±´° ©¸ª² ¨¸ªß øƪ ·²™±¥™ªº ·² ¨¸ª æ·±¥±¹·½ø¥ ø½¨·™·¨ß ±º ¨¸ª ³±¥ª½´¥ªÚ ›±²¶´¹ø¨ªº °Æ±¨ª·² øƪ ½¥ø·º·ªº ø½½±Æº·²¹ ¨± ¨¸ª ½¸ª³·½ø¥ ²ø¨´Æª ±º ¨¸ª·Æ ²±²Ûø³·²±Ûø½·º ½±³°±²ª²¨Ú ⁄±Æ ª®ø³°¥ªÙ ¹¥ß½±°Æ±¨ª·² ½±²¨ø·² ø ½øÆ汸ߺÆø¨ª ƪ·º´ªÙ ¸øª³±°Æ±¨ª·² ø ¸øª³ ¹Æ±´° ø²º ¥·°±°Æ±¨ª·² ø ¥·°·º ƪ·º´ªÚ ÔÚ ÌÚ Ô Õ¨Æ´½¨´Æª øª ¨Æ´½¨´Æª ±º °ª°¨·ºª ø²º °Æ±¨ª·² øƪ ™ªÆß ™øÆ·ªºÚ øªß æø·½ø¥¥ß ½±²·¨ ±º ½¸ø·² ±º ø³·²± ø½·º ƪ·º´ª¯⁄·¹´Æª ÔÚίæ˜Ù ÔÚί½˜ ø²º ÔÚȘÚøªª ½¸ø·² ³øß æª æÆø²½¸ªº º´ª ¨± ¨¸ª °Æªª²½ª ±º ³´¥¨·Ûæø·½ ±Æ ø½·º·½ ø³·²± ø½·º ƪ·º´ª ·² ¨¸ª ½¸ø·² ¯⁄·¹´Æª ÔÚȯº˜˜Ú ײ øºº·¨·±²Ù æÆ·º¹ª ¯½Æ± ¥·²µ˜ ³øß æª º±Æ³ªº 檨©ªª² º·ººªÆª²¨ ª½¨·±² ±º ¨¸ª ø³ª ½¸ø·² ±Æ º·ººªÆª²¨ ½¸ø·²Ú ›ß¨ª·²ª ƪ·º´ªÙ º±Æ ª®ø³°¥ªÙ øƪ ƪ°±²·æ¥ª º±Æ ¨¸ª ÕõÕ æÆ·º¹ª 檨©ªª² ¨¸ª ¨©± °ª°¨·ºª ½¸ø·² ¨¸ø¨ º±Æ³ ¨¸ª ¨Æ´½¨´Æª ±º ·²´¥·² ¯⁄·¹´Æª ÔÚȯª˜˜Ú øª æø·½ ¨Æ´½¨´Æª ±º °ª°¨·ºª ø²º °Æ±¨ª·² · ¨©·¨ªº ·²¨± ø ½±²º±Æ³ø¨·±² ¯¨·³ª ºª°ª²ºª²¨ ±™ªÆø¥¥ ¸ø°ª˜ ½¸øÆø½¨ªÆÛ ·¨·½ ±º ¨¸ø¨ °ª°¨·ºª ±Æ °Æ±¨ª·²Ú øªª ½±²º±Æ³ø¨·±² øƪ ºª°ª²ºª²¨ ±² 汨¸ ¨¸ª ²ø¨´Æª ±º ¨¸ª·Æ æ·±¥±¹·½ø¥ ª²™·Æ±²³ª²¨ ø ©ª¥¥ ø ¨¸ª·Æ ½¸ª³·½ø¥ ¨Æ´½¨´ÆªÚ øª øæ·¥·¨ß ±º °ª°¨·ºª ø²º °Æ±¨ª·² ¨± ½øÆÆß ±´¨ ¨¸ª·Æ æ·±¥±¹·½ø¥ º´²½¨·±² · ²±Æ³ø¥¥ß ºª°ª²ºª²¨ ±² ¨¸· ½±²º±Æ³ø¨·±²Ú fl²ß ½¸ø²¹ª ¨± ø²ß °øƨ ±º ¨¸ª ¨Æ´½¨´Æª ±º ø “ “ “ “ ⁄ª “ ÿ“ ›ÿÓ›ÿ ›—“ÿ “ÿ›— ÿÌ› ÿ——› ›——ÿ ›ÿÌ ›ÿÌ ›ÿ ÿÓ› Ó ›ÿ ›ÿ ÿÌ› –ª°¨·ºª ½¸ø·² ÿ·¨·º·²ª ƪ·º´ª ¯ø˜ ‹ª±®ßÛ¸øª³±¹¥±æ·² ¯ºª±®ßÛÿæ˜ ¯æ˜ —®ßÛ¸øª³±¹¥±æ·² ¯±®ßÛÿæ˜ “ “ “ “ ⁄ª “ ÿ“ ›ÿÓ›ÿ ›—“ÿ “ÿ›— ÿÌ› ÿ——› ›——ÿ ›ÿÌ ›ÿÌ ›ÿ ÿÓ› Ó ›ÿ ›ÿ ÿÌ› — — ⁄·¹´Æª ÔÚÍ Ã¸ª ¨Æ´½¨´Æª ±º ¨¸ª ¸øª³ ƪ·º´ª ·² ºª±®ßÛ ø²º ±®ßÛ¸øª³±¹¥±æ·²Ú ײ ºª±®ßÛÿæ ¨¸ª æ±²º·²¹ ±º ¨¸ª ·Æ±² · °ßÆø³·ºø¥ ©¸·¥¨ ·² ±®ßÛÿæ ·¨ · ±½¨ø¸ªºÆø¥ Í fi×—‘—Ÿ×›fl‘ ”—‘¤›À‘¤Õ
PEPTIDES AND PROTEINS 2 NH NHCOCH CHCH CHCOOH (NHJTyr-Gly-Gly-Pbe-Mct(COOH) HsCH2C YGGFM CONHCH.COOH ) (NH2/Tyr-Gly-Gly-Pbe-Met-Thr-Ser-Clu-Lys-Ser-@lu-Thr-Pro-Leu-Val (HOOC)Glu-Gly-Lys-Lys-Tyr-Ala-Asn-Lys-Ile-Ile-Ala-Asn-Lys-Fbe-Leu-Thr (H)YGGFMTSEKSETPLVTLFKNAIIKNATKKGE(OH) CHOH CHOH HNCH CH,CHCHCH CONHCH CH2 NHCOCHNHCO CHNHCONH NH Val Interchain S-S bridge C-terminal 念 (COOH or OH) -S-S-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Aag-Tyr-Cys-Am 9 Thr Ser leu S-bridge Gln-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Arg-Gly-Phe-Pho 17 used to The nis used fo ns.In both N-te s of the pept e ch y on the tructur nstituent of all cella where it ia involved in a number of hiologiea peptide has opate dtobe produced in the body to counte The ic acid reai the chain ching.(e)Insulin,the hormone that is responsible for controlling glucose metabolisn
¯“ÿÓ ˜ÃßÆñŸ¥ßñŸ¥ßñ–¸ªñ”ª¨ñøÆñÕªÆñŸ¥´ ñ‘ßñÕªÆñŸ¥´ñøÆñ–Ʊñ‘ª´ñ ø¥ ¯ÿ——›˜Ÿ¥´ñŸ¥ßñ‘ßñ‘ßñÃßÆñfl¥øñfl²ñ‘ßñ×¥ªñ×¥ªñfl¥øñfl²ñ‘ßñ–¸ªñ‘ª´ñÃ¸Æ ¯ÿ˜ «ŸŸ⁄”ÃÕ¤’դÖ‘ Ñ⁄’“fl××’“flÃ’’Ÿ¤¯—ÿ˜ ÿÕ›ÿÓ ›ÿ “ÿ›—›ÿÓ›ÿÓ›ÿÓ›ÿ›——ÿ ›—“ÿ›ÿÓ›——ÿ “ÿÓ “ÿÓ ¯æ˜ ¯ø˜ «ŸŸ⁄” ¯“ÿÓ ˜ÃßÆñŸ¥ßñŸ¥ßñ–¸ªñ”ª¨¯›——ÿ˜ ÿ·ñ‘ª´ñ ø¥ñŸ¥´ñfl¥øñ‘ª´ñÃßÆñ‘ª´ñ ø¥ñ›ßñŸ¥ßñflƹñŸ¥ßñ–¸ªñ–¸ª ›ßñÕñÕñ›ßñÕªÆñ‘ª´ñÃßÆñŸ¥²ñ‘ª´ñŸ¥´ñfl¹ñÃßÆñ›ßñfl² –Ʊ ‘ß Ã¸Æ Ÿ¥² ›ß øƣ ÕªÆ £ ×¥ª´ Ÿ¥´ ø¥ ×¥´ª Ÿ¥ß “Û¨ªÆ³·²ø¥ ½¸ø·² ª²º ¯“ÿÓ ±Æ ÿ˜ Ÿ¥² ÕªÆ ÃßÆ Õ Ã¸Æ Õ ¯ª˜ ÕÛÕ æÆ·º¹ª ‘ª´ ÿ· Ÿ¥² fl¹ ø¥ –¸ª ›ß Õ Õ ¯½˜ ײ¨ªÆ½¸ø·² ÕÛÕ æÆ·º¹ª ײ¨ªÆ½¸ø·² ÕÛÕ æÆ·º¹ª ›Û¨ªÆ³·²ø¥ ½¸ø·² ª²º ¯›——ÿ ±Æ —ÿ˜ ÿÓ“›ÿÓ›ÿÓ›ÿÓ›ÿ›ÿÓ›—“ÿ›ÿ “ÿÓ ›— ›— ›ÿÓ—ÿ ›ÿÓ—ÿ ›ÿÓ “ÿ›—›ÿ“ÿ›— “ÿ›ÿ›—“ÿ›ÿ › “ÿ ›ÿ“ÿ›—“ÿÓ “ÿ ÿ— “ÿ “ÿ ¯º˜ ⁄·¹´Æª ÔÚÈ Œª°Æªª²¨ø¨·±² ±º ¨¸ª °Æ·³øÆß ¨Æ´½¨´Æª ±º °ª°¨·ºªÚ é± ߨª³ ±º øæƪ™·ø¨·±² øƪ ´ªº ¨± ƪ°Æªª²¨ °Æ·³øÆß ¨Æ´½¨´ÆªÚ øª ·²¹¥ª ¥ª¨¨ªÆߨª³ · ´ªº º±Æ ½±³°´¨ªÆ °Æ±¹Æø³Úײ 汨¸ ߨª³ ¨¸ª “Û¨ªÆ³·²´ ±º ¨¸ª °ª°¨·ºª ½¸ø·² · ´´ø¥¥ß ºÆø©² ±² ¨¸ª ¥ªº¨Û¸ø²º ·ºª ±º ¨¸ª ¨Æ´½¨´ÆªÚ ¯ø˜ ”ª¨Ûª²µª°¸ø¥·²Ú ø· °ª²¨ø°ª°¨·ºª ±½½´Æ·² ¸´³ø² æÆø·² ¨·´ªÚ ¯æ˜ Ÿ¥´¨ø¨¸·±²ªÙ ø² ·³°±Æ¨ø²¨ ½±²¨·¨´ª²¨ ±º ø¥¥ ½ª¥¥Ù ©¸ªÆª ·¨ · ·²™±¥™ªº ·² ø ²´³æªÆ ±º æ·±¥±¹·½ø¥ °Æ±½ªªÚ ¯½˜ æÛ¤²º±Æ°¸·²Ú ø· ª²º±¹ª²±´ °ª°¨·ºª ¸ø ±°·ø¨ª ø½¨·™·¨ß ø²º · 檥·ª™ªº ¨± æª °Æ±º´½ªº ·² ¨¸ª æ±ºß ¨± ½±´²¨ªÆ °ø·²Ú ¯º˜ ·±³ß½·²Ù ø °±¥ß°ª°¨·ºª ø²¨·æ·±¨·½ °Æ±º´½ªº æß Õ¨Æª°¨±³ß½ª ¹Æ·ª±™ªÆ¨·½·¥¥ø¨´ ™øÆÚ ¨´æªÆø½¨·½´Ú øª °Æªª²½ª ±º ¨¸ª º·æø·½ ÓÙÌÛº·ø³·²±°Æ±ø²±·½ ø½·º ƪ·º´ª °Æ±º´½ª ¨¸ª ½¸ø·² æÆø²½¸·²¹Ú ¯ª˜ ײ´¥·²Ù ¨¸ª ¸±Æ³±²ª ¨¸ø¨ · ƪ°±²·æ¥ª º±Æ ½±²¨Æ±¥¥·²¹ ¹¥´½±ª ³ª¨øæ±¥·³ –¤–Ã׋¤Õ fl“‹ –Œ—Ã¤×“Õ È
NOLOGICALMOLECULES peptide or protein will either change or destroy the compound's biological activity.For example,sickle-cell anaemia (Appendix 1)is caused by the replace- ment of a glutamine residue by a valine residue structure of haemoglobin. Proteins are often referred to as globular and fibrous proteins according to their conformation.Globular proteins are usually soluble in water,whilst fibrous proteins are usually insoluble.The complex nature of their structures has res ted in the use of a sub-classification,sometimes referred to as the order of protein stru ctures.This classification divides the structure into into primary, secondary,tertiary and quaternary orders of structures of peptides and proteins is the sequence of amino a d res s in the mole Figure.1.7 med by th 80 pep and prot 0 the p-ple int ucture is the of the molecule.Tertiary are often for by the eptide chain folding back on itself These folded stm tures are stahilize 3 brid bonding.salt brido (Figure 1.9(a))and van der Waalsforces within the tide chain and also with molecules in the eptide's environment.They are also influenced by hydropho bic interactions between the peptide chain and its environment.Hydrophobic interaction is thought to be mainly responsible for the folded shape of the B-peptide chain of human haemoglobin (Figure 1.9(b)).In this structure the hydrophilic groups of the peptide chain are on the outer surface of the folded structure. ary are the three dimensional protein structures formed by the noncovalent ons of a number of individual peptides and polypeptide molecules.These individual peptide and polypeptide mo cules are kown as subunits.They may or may not be the same emoglobi 1,101 example,cons sts of four s bunits,two a-and two B-units held together by hydrogen d sa proteinsus ly contain erous i min an y str on th The ph c po ble 1 3) he str
°ª°¨·ºª ±Æ °Æ±¨ª·² ©·¥¥ ª·¨¸ªÆ ½¸ø²¹ª ±Æ ºª¨Æ±ß ¨¸ª ½±³°±´²ºê æ·±¥±¹·½ø¥ ø½¨·™·¨ßÚ ⁄±Æ ª®ø³°¥ªÙ ·½µ¥ªÛ½ª¥¥ ø²øª³·ø ¯fl°°ª²º·® Ô˜ · ½ø´ªº æß ¨¸ª ƪ°¥ø½ªÛ ³ª²¨ ±º ø ¹¥´¨ø³·²ª ƪ·º´ª æß ø ™ø¥·²ª ƪ·º´ª ¨Æ´½¨´Æª ±º ¸øª³±¹¥±æ·²Ú –Ʊ¨ª·² øƪ ±º¨ª² ƪºªÆƪº ¨± ø ¹¥±æ´¥øÆ ø²º º·æƱ´ °Æ±¨ª·² ø½½±Æº·²¹ ¨± ¨¸ª·Æ ½±²º±Æ³ø¨·±²Ú Ÿ¥±æ´¥øÆ °Æ±¨ª·² øƪ ´´ø¥¥ß ±¥´æ¥ª ·² ©ø¨ªÆÙ ©¸·¥¨ º·æƱ´ °Æ±¨ª·² øƪ ´´ø¥¥ß ·²±¥´æ¥ªÚ øª ½±³°¥ª® ²ø¨´Æª ±º ¨¸ª·Æ ¨Æ´½¨´Æª ¸ø ƪ´¥¨ªº ·² ¨¸ª ´ª ±º ø ´æÛ½¥ø·º·½ø¨·±²Ù ±³ª¨·³ª ƪºªÆƪº ¨± ø ¨¸ª ±ÆºªÆ ±º °Æ±¨ª·² ¨Æ´½¨´ÆªÚ ø· ½¥ø·º·½ø¨·±² º·™·ºª ¨¸ª ¨Æ´½¨´Æª ·²¨± ·²¨± °Æ·³øÆßÙ ª½±²ºøÆßÙ ¨ªÆ¨·øÆß ø²º Ø´ø¨ªÆ²øÆß ±ÆºªÆ ±º ¨Æ´½¨´ÆªÚ øª °Æ·³øÆß °Æ±¨ª·² ¨Æ´½¨´Æª ±º °ª°¨·ºª ø²º °Æ±¨ª·² · ¨¸ª ªØ´ª²½ª ±º ø³·²± ø½·º ƪ·º´ª ·² ¨¸ª ³±¥ª½´¥ª ¯⁄·¹´ÆªÚ ÔÚÈ˜Ú Õª½±²ºøÆß °Æ±¨ª·² ¨Æ´½¨´Æª øƪ ¨¸ª ¥±½ø¥ ƪ¹´¥øÆ ø²º Æø²º±³ ½±²º±Æ³ø¨·±² ø´³ªº æß ª½¨·±² ±º ¨¸ª °ª°¨·ºª ½¸ø·² º±´²º ·² ¨¸ª ¨Æ´½¨´Æª ±º °ª°¨·ºª ø²º °Æ±¨ª·²Ú øª ³ø·² ƪ¹´¥øÆ ½±²º±Æ³ø¨·±² º±´²º ·² ¨¸ª ª½±²ºøÆß ¨Æ´½¨´Æª ±º °Æ±¨ª·² øƪ ¨¸ª øÛ¸ª¥·®Ù ¨¸ª æÛ°¥ªø¨ªº ¸ªª¨ ø²º ¨¸ª ¨Æ·°¥ª ¸ª¥·® ¯⁄·¹´Æª ÔÚË˜Ú Ã¸ªª ø²º ±¨¸ªÆ Æø²º±³ ½±²º±Æ³ø¨·±² øƪ 檥·ª™ªº ¨± æª ³ø·²¥ß º´ª ¨± ·²¨Æø³±¥ª½´¥øÆ ¸ßºÆ±¹ª² æ±²º·²¹ 檨©ªª² º·ººªÆª²¨ ª½¨·±² ±º ¨¸ª °ª°¨·ºª ½¸ø·²Ú øª ¨ªÆ¨·øÆß °Æ±¨ª·² ¨Æ´½¨´Æª · ¨¸ª ±™ªÆø¥¥ ¸ø°ª ±º ¨¸ª ³±¥ª½´¥ªÚ êƨ·øÆß ¨Æ´½¨´Æª øƪ ±º¨ª² º±Æ³ªº æß ¨¸ª °ª°¨·ºª ½¸ø·² º±¥º·²¹ æø½µ ±² ·¨ª¥ºÚ øªª º±¥ºªº ¨Æ´½¨´Æª øƪ ¨øæ·¥·¶ªº æß ÕõÕ æÆ·º¹ªÙ ¸ßºÆ±¹ª² æ±²º·²¹Ù ø¥¨ æÆ·º¹ª ¯⁄·¹´Æª ÔÚÁ¯ø˜˜ ø²º ™ø² ºªÆ .øø¥ê º±Æ½ª ©·¨¸·² ¨¸ª °ª°¨·ºª ½¸ø·² ø²º ø¥± ©·¨¸ ³±¥ª½´¥ª ·² ¨¸ª °ª°¨·ºªê ª²™·Æ±²³ª²¨Ú øªß øƪ ø¥± ·²º¥´ª²½ªº æß ¸ßºÆ±°¸±Û æ·½ ·²¨ªÆø½¨·±² 檨©ªª² ¨¸ª °ª°¨·ºª ½¸ø·² ø²º ·¨ ª²™·Æ±²³ª²¨Ú ÿߺƱ°¸±æ·½ ·²¨ªÆø½¨·±² · ¨¸±´¹¸¨ ¨± æª ³ø·²¥ß ƪ°±²·æ¥ª º±Æ ¨¸ª º±¥ºªº ¸ø°ª ±º ¨¸ª æÛ°ª°¨·ºª ½¸ø·² ±º ¸´³ø² ¸øª³±¹¥±æ·² ¯⁄·¹´Æª ÔÚÁ¯æ˜ ˜Ú ײ ¨¸· ¨Æ´½¨´Æª ¨¸ª ¸ßºÆ±°¸·¥·½ ¹Æ±´° ±º ¨¸ª °ª°¨·ºª ½¸ø·² øƪ ±² ¨¸ª ±´¨ªÆ ´Æºø½ª ±º ¨¸ª º±¥ºªº ¨Æ´½¨´ÆªÚ œ´ø¨ªÆ²øÆß °Æ±¨ª·² ¨Æ´½¨´Æª øƪ ¨¸ª ¨¸Æªª º·³ª²·±²ø¥ °Æ±¨ª·² ¨Æ´½¨´Æª º±Æ³ªº æß ¨¸ª ²±²½±™ø¥ª²¨ ø±½·ø¨·±² ±º ø ²´³æªÆ ±º ·²º·™·º´ø¥ °ª°¨·ºª ø²º °±¥ß°ª°¨·ºª ³±¥ª½´¥ªÚ øªª ·²º·™·º´ø¥ °ª°¨·ºª ø²º °±¥ß°ª°¨·ºª ³±¥ª½´¥ª øƪ µ²±©² ø ´æ´²·¨Ú øªß ³øß ±Æ ³øß ²±¨ æª ¨¸ª ø³ªÚ ÿøª³±¹¥±æ·²Ù º±Æ ª®ø³°¥ªÙ ½±²·¨ ±º º±´Æ ´æ´²·¨Ù ¨©± øÛ ø²º ¨©± æÛ´²·¨ ¸ª¥º ¨±¹ª¨¸ªÆ æß ¸ßºÆ±¹ª² æ±²º ø²º ø¥¨ æÆ·º¹ªÚ øª ¨Æ´½¨´Æª ±º °ª°¨·ºª ø²º °Æ±¨ª·² ´´ø¥¥ß ½±²¨ø·² ²´³ªÆ±´ ø³·²± ø²º ½øÆ汮ߥ·½ ø½·º ¹Æ±´°Ú ›±²ªØ´ª²¨¥ßÙ ©ø¨ªÆ±¥´æ¥ª °Æ±¨ª·²·² øØ´ª±´±¥´¨·±² ½ø² º±Æ³ º·ººªÆª²¨¥ß ½¸øƹªº ¨Æ´½¨´Æª ø²º ¶©·¨¨ªÆ·±² ºª°ª²º·²¹ ±² ¨¸ª °ÿ ±º ¨¸ª ±¥´¨·±² ¯ªª ÔÚÓÚÓ˜Ú Ã¸ª °ÿ ø¨ ©¸·½¸ ¨¸ª ¥ø¨¨ªÆ ±½½´Æ · µ²±©² ø ¨¸ª ·±ª¥ª½¨Æ·½ °±·²¨ ¯°×˜ ±º ¨¸ª °Æ±¨ª·² ¯Ãø楪 ÔÚÌ˜Ú Ã¸ª ²ø¨´Æª ±º ¨¸ª ½¸øƹª ±² ¨¸ª ¨Æ´½¨´Æª ±º °ª°¨·ºª ø²º °Æ±¨ª·² ¸ø ø ½±²·ºªÆø楪 ªººª½¨ ±² ¨¸ª·Æ±¥´æ·¥·¨ß Ë fi×—‘—Ÿ×›fl‘ ”—‘¤›À‘¤Õ